Semaglutide is a long-acting glucagon-like peptide-1 receptor (GLP-1R) agonist. Medications based on semaglutide are currently widely used for the treatment of type 2 diabetes and obesity. Semaglutide physiologically mimics the function of endogenous GLP-1 hormone, promoting insulin secretion and suppressing glucagon secretion. It also slows gastric emptying, thereby helping patients control their food intake and body weight. This product is a recombinant E. coli-expressed semaglutide backbone. It is an intermediate peptide composed of 29 amino acids and serves as the starting peptide material for semaglutide synthesis. It is provided in lyophilized powder form. Features Animal-Origin Free: Produced using recombinant technology with no animal-derived materials, eliminating the risk of exogenous viral contamination. Stable Quality: Scalable batch production ensures high consistency and minimal lot-to-lot variation. High Production Capacity: Equipped with 5 L–1500 L fermentation systems, Yeasen Biotech supports diverse customer needs across research, pilot, and manufacturing scales. Components Name 20381ES01 20381ES03 20381ES08 20381ES25 20381ES60 Leupeptin (Ultra Pure) 100 mg 1 g 5 g 25 g 100 g Specifications Cas No. 1169630-82-3 Peptide Sequence EGTFTSDVSSYLEGQAAKEFIAWLVRGRG-OH Source Expressed in E. coli Molecular Weight 3175.5 ± 1.0 Da Appearance Lyophilized powder Purity ≥95% Storage This product should be stored at -25~-15℃ for 2 years. Notes 1. For your safety and health, wear a lab coat and disposable gloves while handling this product. 2. This product is intended for research use only. Documents: Safety Data Sheet 20381_MSDS_HB251022_EN.PDF Manuals 20381_Manual_Ver.EN20251022.pdf
Related
Related
Related