Catalase (KatA) from Helicobacter pylori is an enzyme used as biomarker for diagnostic of duodenal ulcer (DU). Overview Product Name: Catalase Catalog No.: P2020-127 RefSeq Links: UniProt: P77872; NP_207669.1; NC_000915.1; WP_000247370.1;, NC_018939.1; PDB: 1QWL; 2IQF Synonyms: KatA Sequence Information Species: Helicobacter pylori Tags: GFP/His-Tag, C-terminal Sequence without tags (AA 1-505): MVNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLEKLAAFDRERIPERVVHAKGSGAYGTFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGERGSADAVRDPRGFAMKYYTEEGNWDLVGNNTPVFFIRDAIKFPDFIHTQKRDPQTNLPNHDMVWDFWSNVPESLYQVTWVMSDRGIPKSFRHMDGFGSHTFSLINAKGERFWVKFHFHTMQGVKHLTNEEAAEVRKYDPDSNQRDLFNAIARGDFPKWKLSIQVMPEEDAKKYRFHPFDVTKIWYLQDYPLMEVGIVELNKNPENYFAEVEQAAFSPANVVPGIGYSPDRMLQGRLFSYGDTHRYRLGVNYPQIPVNKPRCPFHSSSRDGYMQNGYYGSLQNYTPSSLPGYKEDKSARDPKFNLAHIEKEFEVWNWDYRADDSDYYTQPGDYYRSLPADEKERLHDTIGESLAHVTHKEIVDKQLEHFKKADPKYAEGVKKALEKHQKMMKDMHGKDMHHTKKKK Product Information Expression Host: E. coli Formulation: PBS; pH 7.4. Format: Liquid, stored and shipped at -80°C Purity: > 75% as determined by SDS-PAGE Background Information Catalases are conserved and abundant enzymes found in all domains of life. They protect against oxidative stress and are highly expressed. In the gastric pathogen Helicobacter pylori, KatA levels are estimated to be up to 4-5% of the total protein content. The presence of the enzyme is ubiquitous, it could be detected in the cytoplasm, the periplasm and on the cell surface as well as being readily detected extracellularly. The enzyme is described to use heme as cofactor.KatA is used as biomarker for duodenal ulcer (DU) and also for gastritic cancer (GC). SDS-PAGE/Coll. Coomassie Histogram of marked lane in gel picture Download Download Product Information for Catalase
