Recombinant Bacillus subtilis Small basic protein(sbp)

GeneBio Verified independent store

→

Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Bacillus subtilis (strain 168)Uniprot NO.:P28265Tag Info:The tag type will be de termined during production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:MWLPVLGLVLGIAIGLMTNLTIPSEYSNYLSLAVLAALDTLIGGIRAHLQGTYDEMVFVS GFFFNIILAISLAFLGVHLGVDLYLAGIFAFGVRLFQNIAVIRRNLLTKWTLSKKNKKNV IProtein Names:Recommended name: Small basic proteinGene Names:Name:sbp Ordered Locus Names:BSU15270Expression Region:1-121Sequence Info:full length protein Show more