Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 22-32 working daysResearch Topic: OthersUniprot ID: Q0Z972Gene Names: IL10Organism: Callithrix jacchus (White-tufted-ear marmoset)AA Sequence: SPGQGTQSENSCTHFPGSLPHMLRELRVAFSRVKTFFQKKDQLDSMLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGEKLKTFRLRLRRCHRFLPCENKSKAVVQVKNAVSKLQEKGIYKAMSEFDIFIDYIEAYMTMKAQNExpression Region: 19-178aaSequence Info: Full LengthSource: YeastTag Info: N-terminal 6xHis-taggedMW: 20.6 kDaAlternative Name(s): Cytokine synthesis inhibitory factor ;CSIFRelevance: Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.Reference: Common marmoset interleukin 10.Yamabe E., Kohu K., Suemizu H., Sasaki E., Tanioka Y., Yagita H., Habu S., Satake M. Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
