Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 10-20 working daysResearch Topic: OthersUniprot ID: Q98SS5Gene Names: DCXOrganism: Gallus gallus (Chicken)AA Sequence: MELDFGHFDERDKASRNMRGTRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANQKAPQSLASSNSAQAKENKDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDESECRVMKGSPAAATGSKSSPTPQKSSAKSPAPMRRSKSPADSANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKVDLYLPLSLDDSDSLGDSMExpression Region: 1-361aaSequence Info: Full LengthSource: E.coliTag Info: N-terminal 6xHis-taggedMW: 44 kDaAlternative Name(s): Relevance: Reference: Screening from a subtracted embryonic chick hindbrain cDNA library identification of genes expressed during hindbrain, midbrain and cranial neural crest development.Christiansen J.H., Coles E.G., Robinson V., Pasini A., Wilkinson D.G.Mech. Dev. 102:119-133(2001)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Related
Related
Related
Related