Size: 10ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 15-20 working daysResearch Topic: OthersUniprot ID: P06871Gene Names: N/AOrganism: Canis lupus familiaris (Dog) (Canis familiaris)AA Sequence: IVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKIIRHPRYNANTIDNDIMLIKLSSPATLNSRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKAPILSDSVCRNAYPGQISSNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVSPKVCKYVSWIQQTIAANExpression Region: 24-246aaSequence Info: Full LengthSource: in vitro E.coli expression systemTag Info: N-terminal 6xHis-SUMO-taggedMW: 39.6 kDaAlternative Name(s): Relevance: Reference: "Differential regulation of trypsinogen mRNA translation: full-length mRNA sequences encoding two oppositely charged trypsinogen isoenzymes in the dog pancreas."Pinsky S.D., Laforge K.S., Scheele G.Mol. Cell. Biol. 5:2669-2676(1985) Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.