Recombinant Enterococcus faecalis ATP synthase subunit b(atpF)

GeneBio Verified independent store

→

Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Enterococcus faecalis (strain ATCC 700802 / V583)Uniprot NO.:Q831A1Tag Info:The tag type will be determined during production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:MLLTTLVVGETAPSTTLGTMIVVSGAFLILMLLLKKYAWGAIVDILTQREEKIANDLDSA EQSRVAAAKMEKERQQQLLSSRSEAAEIIKNAKESGEQTRQKTLKETTAEVTRLREKART DISQEREEALSSVKNEVADLSLQIAAKILNKELTPDAHEALIDSYIESLGKANETRProtein Names:Recommended name: ATP synthase subunit b Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I F-type ATPase subunit b Short name= F-ATPase subunit bGene Names:Name:atpF Ordered Locus Names:EF_2612Expression Region:1-176Sequence Info:full length protein Show more