Recombinant Eucalyptus globulus subsp. globulus Cytochrome b559 subunit alpha(psbE)

GeneBio Verified independent store

→

Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Eucalyptus globulus subsp. globulus (Tasmanian blue gum)Uniprot NO.:Q49KY2Tag In fo:The tag type will be determined during production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITGRFDPLEQLDEFSRSFProtein Names:Recommended name: Cytochrome b559 subunit alpha Alternative name(s): PSII reaction center subunit VGene Names:Name:psbEExpression Region:1-83Sequence Info:full length protein Show more