Recombinant GDNF, Human - BK0208

AFSBio Inc. Verified independent store

→

Recombinant GDNF, Human Catalogue Numbers: BK0208-10, BK0208-50 Sizes: 10μg, 50μg Source: CHO Molecular Weight: 30.4 kDa (homo-dimer), observed by non-reducing SDS-PAGE. Purity: > 95% as analyzed by SDS-PAGE and HPLC. Biological Activity: ED50< 1 µg/ml, measured in a cell proliferation assay using rat C6 cells, corresponding to a specific activity of >1 x 10ˆ3 units/mg Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDL SFLDDNLVYHILRKHSAKRCGCI Endotoxin: Show more