Recombinant Human Bcl-2-interacting killer(BIK)

GeneBio Verified independent store

→

Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Homo sapiens (Human)Uniprot NO.:Q13323Tag Info:The tag type will be determined d uring production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALR LACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMR FWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLKProtein Names:Recommended name: Bcl-2-interacting killer Alternative name(s): Apoptosis inducer NBK BIP1 BP4Gene Names:Name:BIK Synonyms:NBKExpression Region:1-160Sequence Info:full length protein Show more