Recombinant Human Blood group Rh(D) polypeptide(RHD),partial

GeneBio Verified independent store

→

Size: 20ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 15-25 working daysResearch Topic: CardiovascularUniprot ID: Q02161Gene Names: RHDOrganism: Homo sa piens (Human)AA Sequence: LNLKIWKAPHEAKYFDDQVFWKFPHLAVGFExpression Region: 388-417aaSequence Info: PartialSource: Mammalian cellTag Info: N-terminal GST-taggedMW: 29.6 kDaAlternative Name(s): RHXIII Rh polypeptide 2 Short name: RhPII Rhesus D antigen CD_antigen: CD240DRelevance: May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.Reference: "Rh(D) antigen expression and isolation of a new Rh(D) cDNA isoform in human erythroleukemic K562 cells." Suyama K., Lunn R., Haller S., Goldstein J. Blood 84:1975-1981(1994)Purity: Greater than 85% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. Show more