Recombinant Human Bone sialoprotein 2 (IBSP),partial

GeneBio Verified independent store

→

Size: 200ug. Other sizes are also available. Please Inquire.In Stock: YesLead time: 3-7 working daysResearch Topic: OthersUniprot ID: P21815Gene Names: IBSPOrganism: Homo sapiens ( Human) AA Sequence: AIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYESEExpression Region: 129-281aaSequence Info: Partial Source: E.coliTag Info: N-terminal 6xHis-SUMO-taggedMW: 32.4 kDaAlternative Name(s): Bone sialoprotein IIRelevance: Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Promotes Arg-Gly-Asp-dependent cell attachment.Reference: "Human bone sialoprotein. Deduced protein sequence and chromosomal localization." Fisher L.W., McBride O.W., Termine J.D., Young M.F. J. Biol. Chem. 265:2347-2351(1990)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. Show more