Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 10-20 working daysResearch Topic: CardiovascularUniprot ID: P23946Gene Names: CMA1Organism: Homo sapiens (Human)AA Sequence: IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQANExpression Region: 22-247aaSequence Info: Full LengthSource: E.coliTag Info: N-terminal 6xHis-taggedMW: 29 kDaAlternative Name(s): Alpha-chymase Mast cell protease IRelevance: Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, Extracellular domain matrix degradation, and regulation of gland secretion.Reference: "Cloning of the gene and cDNA for human heart chymase."Urata H., Kinoshita A., Perez D.M., Misono K.S., Bumpus F.M., Graham R.M., Husain A.J. Biol. Chem. 266:17173-17179(1991)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
