Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 10-20 working daysResearch Topic: CancerUniprot ID: P05013Gene Names: IFNA6Organism: Homo sapiens (Human)AA Sequence: SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKEExpression Region: 21-189aaSequence Info: Full Length of Mature ProteinSource: E.coliTag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedMW: 25.1 kDaAlternative Name(s): Interferon alpha-54 Interferon alpha-K Short name: LeIF KRelevance: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.Reference: "Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes." Janssen R., Bont L., Siezen C.L., Hodemaekers H.M., Ermers M.J., Doornbos G., van 't Slot R., Wijmenga C., Goeman J.J., Kimpen J.L., van Houwelingen H.C., Kimman T.G., Hoebee B. J. Infect. Dis. 196:826-834(2007)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Related
Related
Related
Related