Size: 10ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 15-20 working daysResearch Topic: ImmunologyUniprot ID: P13232Gene Names: IL7Organism: Homo sapiens(Human)AA Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHExpression Region: 26-177aaSequence Info: Full LengthSource: in vitro E.coli expression systemTag Info: N-terminal 6xHis-SUMO-taggedMW: 33.4 kDaAlternative Name(s): Relevance: Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.Reference: "Characterization of the human and murine IL-7 genes."Lupton S.D., Gimpel S., Jerzy R., Brunton L.L., Hjerrild K.A., Cosman D., Goodwin R.G.J. Immunol. 144:3592-3601(1990)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
