Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 10-20 working daysResearch Topic: Tags & Cell Markers Uniprot ID: Q13296Gene Names: SCGB2A2Organism: Homo sapiens (Human)AA Sequence: GSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLFExpression Region: 1-93aaSequence Info: Full Length Source: E.coliTag Info: N-terminal GST-taggedMW: 35.5 kDaAlternative Name(s): Mammaglobin-1 Secretoglobin family 2A member 2Relevance: Reference: "Mammaglobin, a mammary-specific member of the uteroglobin gene family, is overexpressed in human breast cancer." Watson M.A., Fleming T.P. Cancer Res. 56:860-865(1996)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
