Recombinant Human Neutrophil elastase(ELANE)

GeneBio Verified independent store

→

Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 22-32 working daysResearch Topic: Signal TransductionUniprot ID: P08246Gene Names: ELANEOrganism: Homo sapiens (Human)AA Sequence: IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTHExpression Region: 30-267aaSequence Info: Full LengthSource: YeastTag Info: N-terminal 6xHis-taggedMW: 27.6 kDaAlternative Name(s): Bone marrow serine protease;Elastase-2Human leukocyte elastase ;HLEMedullasin;PMN elastaseRelevance: Modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits C5a-dependent neutrophil enzyme release and chotaxis.Reference: Primary structure of human neutrophil elastase.Sinha S., Watorek W., Karr S., Giles J., Bode W., Travis J.Proc. Natl. Acad. Sci. U.S.A. 84:2228-2232(1987)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. Show more