Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 10-20 working daysResearch Topic: MetabolismUniprot ID: Q15004Gene Names: PCLAFOrganism: Homo sapiens (Human)AA Sequence: MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKEExpression Region: 1-111aaSequence Info: Full LengthSource: E.coliTag Info: N-terminal GST-taggedMW: 39 kDaAlternative Name(s): Hepatitis C virus NS5A-transactivated protein 9 ;HCV NS5A-transactivated protein 9Overexpressed in anaplastic thyroid carcinoma 1 ;OEATC-1;PCNA-associated factor of 15KDA ;PAF15 ;p15PAFRelevance: PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.Reference: KIAA0101 is overexpressed, and promotes growth and invasion in adrenal cancer.Jain M., Zhang L., Patterson E.E., Kebebew E.PLoS ONE 6:E26866-E26866(2011)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Related
Related
Related
Related