Recombinant Human Prostate stem cell antigen(PSCA)

GeneBio Verified independent store

→

Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 22-32 working daysResearch Topic: Tags & Cell Markers Uniprot ID: O43653Gene Names: PSCAOrganism: Homo sapiens (Human)AA Sequence: LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASExpression Region: 21-95aaSequence Info: Full Length of Mature ProteinSource: YeastTag Info: N-terminal 6xHis-taggedMW: 10.2 kDaAlternative Name(s): Relevance: May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.1 PublicationReference: "Reduced expression of PSCA, a member of the LY-6 family of cell surface antigens, in bladder, esophagus, and stomach tumors."Bahrenberg G., Brauers A., Joost H.G., Jakse G.Biochem. Biophys. Res. Commun. 275:783-788(2000)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. Show more