Recombinant Human Signal peptidase complex subunit 2(SPCS2)

GeneBio Verified independent store

→

Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Homo sapiens (Human)Uniprot NO.:Q15005Tag Info:The tag type will be determined d uring production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:AAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLD DSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISY FVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRT KQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLAIERKIKProtein Names:Recommended name: Signal peptidase complex subunit 2 EC= 3.4.-.- Alternative name(s): Microsomal signal peptidase 25 kDa subunit Short name= SPase 25 kDa subunitGene Names:Name:SPCS2 Synonyms:KIAA0102, SPC25Expression Region:2-226Sequence Info:full length protein Show more