Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 10-20 working daysResearch Topic: Cancer Uniprot ID: Q9Y6M0Gene Names: PRSS21Organism: Homo sapiens (Human)AA Sequence: IVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQSExpression Region: 42-288aaSequence Info: Full Length of Mature ProteinSource: E.coliTag Info: N-terminal 6xHis-taggedMW: 31.8 kDaAlternative Name(s): Eosinophil serine protease 1Relevance: Could regulate proteolytic events associated with testicular germ cell maturation.Reference: "Testisin, a new human serine proteinase expressed by premeiotic testicular germ cells and lost in testicular germ cell tumors." Hooper J.D., Nicol D.L., Dickinson J.L., Eyre H.J., Scarman A.L., Normyle J.F., Stuttgen M.A., Douglas M.L., Loveland K.A., Sutherland G.R., Antalis T.M. Cancer Res. 59:3199-3205(1999)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
