Recombinant Human Trefoil factor 1(TFF1)

GeneBio Verified independent store

→

Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 10-20 working daysResearch Topic: Signal TransductionUniprot ID: P04155Gene Names: TFF1Organism: Homo sapiens (Human)AA Sequence: EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEFExpression Region: 25-84aaSequence Info: Full LengthSource: E.coliTag Info: N-terminal GST-taggedMW: 33.7 kDaAlternative Name(s): Breast cancer estrogen-inducible protein;PNR-2;Polypeptide P1.A ;hP1.AProtein pS2Relevance: Stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. May inhibit the growth of calcium oxalate crystals in urine.Reference: Trefoil factor family-1 mutations enhance gastric cancer cell invasion through distinct signaling pathways.Yio X., Diamond M., Zhang J.-Y., Weinstein H., Wang L.-H., Werther L., Itzkowitz S.Gastroenterology 130:1696-1706(2006)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. Show more