Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 10-20 working daysResearch Topic: OthersUniprot ID: P82019Gene Names: Defb4Organism: Mus musculus (Mouse)AA Sequence: QIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIRExpression Region: 23-63aaSequence Info: Full LengthSource: E.coliTag Info: N-terminal 6xHis-SUMO-taggedMW: 20.6 kDaAlternative Name(s): Defensin, beta 4Relevance: Has bactericidal activityReference: "A novel murine beta-defensin expressed in tongue, esophagus, and trachea."Jia H.P., Wowk S.A., Schutte B.C., Lee S.K., Vivado A., Tack B.F., Bevins C.L., McCray P.B. Jr.J. Biol. Chem. 275:33314-33320(2000)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
