Recombinant Mouse Beta-synuclein(Sncb)

GeneBio Verified independent store

→

Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 10-20 working daysResearch Topic: OthersUniprot ID: Q91ZZ3Gene Names: SncbOrganism: Mus musculus (Mouse)AA Sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTSGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKKEEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDSPQEEYQEYEPEAExpression Region: 1-133aaSequence Info: Full LengthSource: E.coliTag Info: NO-taggedMW: 14.1 kDaAlternative Name(s): Relevance: May be involved in neuronal plasticity.Reference: "Genomic organization, chromosome location, and expression analysis of mouse beta-synuclein, a candidate for involvement in neurodegeneration." Sopher B.L., Koszdin K.L., McClain M.E., Myrick S.B., Martinez R.A., Smith A.C., La Spada A.R. Cytogenet. Cell Genet. 93:117-123(2001)Purity: Greater than 85% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. Show more