Recombinant Mouse Integral membrane protein 2C(Itm2c)

GeneBio Verified independent store

→

Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Mus musculus (Mouse)Uniprot NO.:Q91VK4Tag Info:The tag type will be determined d uring production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:MVKISFQPAVAGIKADKADKAAASGPASASAPAAEILLTPAREERPPRHRSRKGGSVGGV CYLSMGMVVLLMGLVFASVYIYRYFFLAQLARDNFFHCGVLYEDSLSSQIRTRLELEEDV KIYLEENYERINVPVPQFGGGDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRN FWELLMNVKRGTYLPQTYIIQEEMVVTEHVRDKEALGSFIYHLCNGKDTYRLRRRSTRRR INKRGGKNCNAIRHFENTFVVETLICGVVProtein Names:Recommended name: Integral membrane protein 2C Alternative name(s): Transmembrane protein BRI3 Cleaved into the following chain: 1. CT-BRI3Gene Names:Name:Itm2cExpression Region:1-269Sequence Info:full length protein Show more