Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 22-32 working daysResearch Topic: OthersUniprot ID: Q80ZF2Gene Names: IfneOrganism: Mus musculus (Mouse)AA Sequence: LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDPExpression Region: 22-192aaSequence Info: Full LengthSource: YeastTag Info: N-terminal 6xHis-taggedMW: 22 kDaAlternative Name(s): Interferon epsilon-1Interferon tau-1Relevance: Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the fale reproductive tract. Directly mediates protection against viral, including HSV-2, and bacterial, including Chlamydia muridarum, genital infections.Reference: Characterization of the type I interferon locus and identification of novel genes.Hardy M.P., Owczarek C.M., Jermiin L.S., Ejdebaeck M., Hertzog P.J.Genomics 84:331-345(2004)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
