Size: 200ug. Other sizes are also available. Please Inquire.In Stock: YesLead time: 3-7 working daysResearch Topic: Immunology Uniprot ID: P70380Gene Names: Il18Organism: Mus musculus (Mouse)AA Sequence: MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQSExpression Region: 1-192aaSequence Info: Full LengthSource: YeastTag Info: N-terminal 10xHis-taggedMW: 24.6 kDaAlternative Name(s): Interferon gamma-inducing factorRelevance: Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.Reference: "Active stage of autoimmune diabetes is associated with the expression of a novel cytokine, IGIF, which is located near Idd2." Rothe H., Jenkins N.A., Copeland N.G., Kolb H. J. Clin. Invest. 99:469-474(1997) Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.