Recombinant Mouse Leukemia inhibitory factor(rMuLIF) - PR2005

AFSBio Inc. Verified independent store

→

Recombinant Mouse Leukemia inhibitory factor(rMuLIF) Catalogue Numbers: PR2005-5, PR2005-10 Sizes: 5µg, 10µg Source: Escherichia coli Molecular Weight: Approximately20 kDa, a singl e non-glycosylated polypeptide chain containing 181 amino acids. Purity: >98% by SDS-PAGE and HPLC analyses. Biological Activity: The activity of mouse LIF is determined by the ability to induce differentiation of murine M1myeloid leukemic cells. The minimum detectable concentration of mouse LIF in this assay is0.5 ng/mL. The specific activity is >1 x 108 units/mg, where 50 units is defined as the amountof mouse LIF required to induce differentiation in 50% of the M1 colonies in 1 mL agarcultures. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized from a 0.2μm filtered concentrated solution in 20mM PB, pH 7.4, with 0.02% TWEEN 20. AA Sequence: MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF Endotoxin: Less than 1EU/mg of rmLIF as determined by LAL method. Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at Show more