Size: 200ug. Other sizes are also available. Please Inquire.In Stock: YesLead time: 3-7 working daysResearch Topic: CardiovascularUniprot ID: P04247Gene Names: MbOrganism: Mus musculus (Mouse)AA Sequence: GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQGExpression Region: 2-154aaSequence Info: Full LengthSource: YeastTag Info: N-terminal 6xHis-tagged and C-terminal Myc-taggedMW: 20.4 kDaAlternative Name(s): Relevance: Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.Reference: "The mouse myoglobin gene. Characterisation and sequence comparison with other mammalian myoglobin genes." Blanchetot A., Price M., Jeffreys A.J. Eur. J. Biochem. 159:469-474(1986)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.