Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 10-20 working daysResearch Topic: OthersUniprot ID: P18121Gene Names: Prl3d1Organism: Mus musculus (Mouse)AA Sequence: SKPTAMVPTEDLYTRLAELLHNTFILAADVYREFDLDFFDKTWITDRTLPLCHTASIHTPENREEVHETKTEDLLKAMINVSISWKEPLKHLVSALTALPGASESMGKKAADIKGRNLVILEGLQTIYNRSQANIEENENFDYPAWSGLEELQSPNEDTHLFAVYNLCRCIKRDIHKIDSYIKVLRCRVVFQNECExpression Region: 30-224aaSequence Info: Full Length of Mature ProteinSource: E.coliTag Info: N-terminal 6xHis-taggedMW: 26.4 kDaAlternative Name(s): Chorionic somatomammotropin hormone 1 Placental lactogen IRelevance: Reference: "Trophoblast-specific transcription from the mouse placental lactogen-I gene promoter." Shida M.M., Ng Y.K., Soares M.J., Linzer D.I.H. Mol. Endocrinol. 7:181-188(1993)Purity: Greater than 85% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
