Recombinant Mouse Stromal cell-derived factor 2(Sdf2)

GeneBio Verified independent store

→

Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 10-20 working daysResearch Topic: Signal TransductionUniprot ID: Q9DCT5Gene Names: Sdf2Organism: Mus musculus (Mouse)AA Sequence: SNMAVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKTATVCERGTPIKCGQPIRLTHINTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTDVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLRAEVHHAELExpression Region: 19-211aaSequence Info: Full Length of Mature ProteinSource: E.coliTag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedMW: 26.4 kDaAlternative Name(s): Relevance: Reference: "Isolation and characterization of a novel secretory protein, stromal cell-derived factor-2 (SDF-2) using the signal sequence trap method." Hamada T., Tashiro K., Tada H., Inazawa J., Shirozu M., Shibahara K., Nakamura T., Martina N., Nakano T., Honjo T.Gene 176:211-214(1996)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. Show more