Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Oenococcus oeni (strain ATCC BAA-331 / PSU-1)Uniprot NO.:Q04G25Tag Info:The tag type will be determined during production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:MNYIAAGIALCGSAIGAGIGNGMLMAKLIESIARQPELEGNLRTNMFISMALVEAMPIIV IAMSFVLINEProtein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding proteinGene Names:Name:atpE Ordered Locus Names:OEOE_0660Expression Region:1-70Sequence Info:full length protein