Recombinant Pasteurella multocida Uncharacterized protein PM0682(PM0682)

GeneBio Verified independent store

→

Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Pasteurella multocida (strain Pm70)Uniprot NO.:Q9CMX0Tag Info:The tag type will be determined during production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:MLGYRQAVRHRVLISAFLGSNPSTPAILSNNLHPLHIKIFQLGYRQAVRHRVLISAFLGS NPSTPAITFLNFDFTYFVLRLFYFYFKIFIIFSNLFYRYFPFProtein Names:Recommended name: Uncharacterized protein PM0682Gene Names:Ordered Locus Names:PM0682Expression Region:1-102Sequence Info:full length protein Show more