Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Shigella flexneriUniprot NO.:P69790Tag Info:The tag type will be determined during production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:MFSNHADMMLTQIAIGLCFTLLYFVVFRTLILQFNMCTPGREDAEVKLYSKAEYKASRGQ TTAAEPKKELDQAAGILQALGGVGNISSINNCATRLRIALHDMSQTLDDEVFKKLGAHGV FRSGDAIQVIIGLHVSQLREQLDSLINSHQSAENVAITEAVProtein Names:Recommended name: Phosphotransferase enzyme IIB component glvB EC= 2.7.1.69 Alternative name(s): PTS system EIIB componentGene Names:Name:glvB Ordered Locus Names:SF3780, S3989Expression Region:1-161Sequence Info:full length protein
