Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 22-32 working daysResearch Topic: Signal TransductionUniprot ID: P00761Gene Names: N/AOrganism: Sus scrofa (Pig)AA Sequence: IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAANExpression Region: 9-231aaSequence Info: Full Length of Mature ProteinSource: YeastTag Info: N-terminal 6xHis-taggedMW: 25.5 kDaAlternative Name(s): Relevance: Reference: "Refined 1.6-A resolution crystal structure of the complex formed between porcine beta-trypsin and MCTI-A, a trypsin inhibitor of the squash family. Detailed comparison with bovine beta-trypsin and its complex."Huang Q., Liu S., Tang Y.J. Mol. Biol. 229:1022-1036(1993)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
