Recombinant Polypterus sp. Cytochrome b(mt-cyb)

GeneBio Verified independent store

→

Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Polypterus sp. (Bichir)Uniprot NO.:P29669Tag Info:The tag type will be determine d during production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:MGSLLGLCLIVQIITGLFLAMHYVSDISSAFSSVAHICRDVNYGWLIRNFHANGASLFFI CIYLHIARGLYYGSYLYMETWNIGVILLLLTMMTAFVGYVProtein Names:Recommended name: Cytochrome b Alternative name(s): Complex III subunit 3 Complex III subunit III Cytochrome b-c1 complex subunit 3 Ubiquinol-cytochrome-c reductase complex cytochrome b subunitGene Names:Name:mt-cyb Synonyms:cob, cytb, mtcybExpression Region:1-100Sequence Info:full length protein Show more