Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Escherichia coli O157:H7Uniprot NO.:Q8X9G0Tag Info:The tag type will be determined during production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:MRGLRPALSTFIFLLLITGGVYPLLTTALGQWWFPWQANGSLIREGDTVRGSALIGQNFT DNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKLIAARVAALRAANPNASTSVPVEL VTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVE LNLALDKLDEProtein Names:Recommended name: Potassium-transporting ATPase C chain EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] C chain Potassium-binding and translocating subunit C Potassium-translocating ATPase C chainGene Names:Name:kdpC Ordered Locus Names:Z0843, ECs0724Expression Region:1-190Sequence Info:full length protein