Recombinant Protein AaeX(aaeX)

GeneBio Verified independent store

→

Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Escherichia coli O1:K1 / APECUniprot NO.:A1AGD5Tag Info:The tag type will be det ermined during production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLLPTGIYDFVWHPALFNTALYCCLFY LISRLFVProtein Names:Recommended name: Protein AaeXGene Names:Name:aaeX Ordered Locus Names:Ecok1_32310 ORF Names:APECO1_3202Expression Region:1-67Sequence Info:full length protein Show more