Recombinant Protein spdA(spdA)

GeneBio Verified independent store

→

Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Streptomyces lividansUniprot NO.:P22407Tag Info:The tag type will be determined during production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:MRTPDAQMRAGHIPAHLIPDGTDPRTVVVVHHQAEARDWTGPILLALVAAGGSVGVVMTL CLLLQTAATTATALAAAAPAGVGLSISLKARKGKProtein Names:Recommended name: Protein spdAGene Names:Name:spdAExpression Region:1-94Sequence Info:full length protein Show more