Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 10-20 working daysResearch Topic: OthersUniprot ID: P14756Gene Names: lasBOrganism: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)AA Sequence: AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSALExpression Region: 198-498aaSequence Info: PartialSource: E.coliTag Info: N-terminal 6xHis-SUMO-taggedMW: 49.1 kDaAlternative Name(s): Neutral metalloproteinase PAE Pseudolysin Cleaved into the following chain: Pro-elastaseRelevance: Cleaves host elastin, collagen, IgG, and several complement components as well as endogenous pro-aminopeptidase (PubMed:11533066). Autocatalyses processing of its pro-peptide (PubMed:9642203, PubMed:1744034). Processes the pro-peptide of pro-chitin-binding protein (cbpD) (PubMed:9642203). Involved in the pathogenesis of P.aeruginosa infections.Reference: "Molecular characterization and nucleotide sequence of the Pseudomonas aeruginosa elastase structural gene."Bever R.A., Iglewski B.H.J. Bacteriol. 170:4309-4314(1988)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Related
Related
Related
Related