Recombinant Putative antiporter subunit mnhE2(mnhE2)

GeneBio Verified independent store

→

Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Staphylococcus aureusUniprot NO.:Q0Q2J6Tag Info:The tag type will be determined during production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:MNQIVLNIIIAFLWVLFQDEDHFKFSTFFSGYLIGLIVIYILHRFFSDDFYVRKIWVAIK FLGVYLYQLITSSISTINYILFKTKDMNPGLLSYETRLTSDWSITFLTILIIITPGSTVI RISQDSKKFFIHSIDVSEKEKDSLLRSIKHYEDLILEVSRProtein Names:Recommended name: Putative antiporter subunit mnhE2 Alternative name(s): Mrp complex subunit E2 Putative NADH-ubiquinone oxidoreductase subunit mnhE2Gene Names:Name:mnhE2 Synonyms:mrpE2Expression Region:1-160Sequence Info:full length protein Show more