Recombinant Putative lipoprotein lprH(lprH)

GeneBio Verified independent store

→

Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Mycobacterium tuberculosisUniprot NO.:P65316Tag Info:The tag type will be determ ined during production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:CTESVAGRAMRATDRSSGLPTSAKPARARDLLLQDGDRAPFGQVTQSRVGDSYFTSAVPP ECSAALLFKGSPLRPDGSSDHAEAAYNVTGPLPYAESVDVYTNVLNVHDVVWNGFRDVSH CRGDAVGVSRAGRSTPMRLRYFATLSDGVLVWTMSNPRWTCDYGLAVVPHAVLVLSACGF KPGFPMAEWASKRRAQLDSQVProtein Names:Recommended name: Putative lipoprotein lprHGene Names:Name:lprH Ordered Locus Names:Rv1418, MT1461 ORF Names:MTCY21B4.36Expression Region:28-228Sequence Info:full length protein Show more