Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Yersinia pestisUniprot NO.:Q56956Tag Info:The tag type will be determined during production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:MTYQQAGRVAVIKRIAGWLVFIPALLSTLISIINFVYLYSQKGTGVNAVMLDFIHVMTDM ARFNTPFLNIFWYNSPVPNLEQGLSAGNIMFFIIYMLIFVGLSLQASGARMSRQVRHIRE GIEDQMILERAKGNEGHSREQLEEKIVLPHHTIFLQFFTLYILPSVIGVLGYFVIKLLGI MIQGProtein Names:Recommended name: Putative yfeABCD regulator yfeEGene Names:Name:yfeE Ordered Locus Names:YPO2445, y1891, YP_2232Expression Region:1-184Sequence Info:full length protein
