Size: 200ug. Other sizes are also available. Please Inquire.In Stock: YesLead time: 3-7 working daysResearch Topic: OthersUniprot ID: P37213Gene Names: PPDKOrganism: Entamoeba histolyticaAA Sequence: MQRVYAFEDGDGTNKKLLGGKGAGLCTMTKIGLPVPQGFVITTEMCKQFIANGNKMPEGLMEEVKKEYQLVEKKSGKVFGGEENPLLVSVRSGAAMSMPGMMDTILNLGLNDKTVVALAKLTNNERFAYDSYRRFVSLFGKIALNACDEVYDKTLENKKVEKGVKLDTELDANDMKELAQVFIKKTEEFTKQPFPVDPYAQLEFAICAVFRSWMGKRAVDYRREFKITPEQADGTAVSVVSMVYGNMGNDSATGVCFTRDPGTGENMFFGEYLKNAQGEDVVAGIRTPQIISKMAEDRDLPGCYEQLLDIRKKLEGYFHEVQDFEFTIERKKLYMLQTRNGKExpression Region: 1-342aaSequence Info: PartialSource: E.coliTag Info: N-terminal 6xHis-SUMO-taggedMW: 54.4 kDaAlternative Name(s): Pyruvate, orthophosphate dikinaseRelevance: Catalyzes the reversible phosphorylation of pyruvate and phosphate. In E.histolytica and C.symbiosus, PPDK functions in the direction of ATP synthesis.Reference: Primary structure of the pyruvate phosphate dikinase in Entamoeba histolytica.Bruchhaus I., Tannich E.Mol. Biochem. Parasitol. 62:153-156(1993)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
