Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 10-20 working daysResearch Topic: OthersUniprot ID: P01581Gene Names: IfngOrganism: Rattus norvegicus (Rat)AA Sequence: QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRCExpression Region: 23-156aaSequence Info: Full LengthSource: E.coliTag Info: N-terminal GST-taggedMW: 42.5 kDaAlternative Name(s): Relevance: Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.Reference: Cloning and expression of the chromosomal immune interferon gene of the rat.Dijkema R., van der Meide P.H., Pouwels P.H., Caspers M., Dubbeld M., Schellekens H.EMBO J. 4:761-767(1985)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Related
Related
Related
Related