Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 10-20 working daysResearch Topic: Cell BiologyUniprot ID: P12788Gene Names: Try4Organism: Rattus norvegicus (Rat)AA Sequence: IVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRKLQVRLGEHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETMANNExpression Region: 24-247aaSequence Info: Full Length of Mature ProteinSource: E.coliTag Info: N-terminal 6xHis-taggedMW: 29.6 kDaAlternative Name(s): Pretrypsinogen IV Trypsin IVRelevance: Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.Reference: "A fourth trypsinogen (P23) in the rat pancreas induced by CCK." Luetcke H.A., Rausch U., Vasiloudes P., Scheele G.A., Kern H.F. Nucleic Acids Res. 17:6736-6736(1989)Purity: Greater than 85% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
