Recombinant Staphylococcus aureus Putative antiporter subunit mnhF2(mnhF2)

GeneBio Verified independent store

→

Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Staphylococcus aureus (strain JH9)Uniprot NO.:A5IQI0Tag Info:The tag type will b e determined during production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTSAVVMSIVGVLSVLMG TVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNLProtein Names:Recommended name: Putative antiporter subunit mnhF2 Alternative name(s): Mrp complex subunit F2 Putative NADH-ubiquinone oxidoreductase subunit mnhF2Gene Names:Name:mnhF2 Synonyms:mrpF2 Ordered Locus Names:SaurJH9_0650Expression Region:1-100Sequence Info:full length protein Show more