Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 22-32 working daysResearch Topic: OthersUniprot ID: Q99V46Gene Names: sspBOrganism: Staphylococcus aureus (strain Mu50 / ATCC 700699)AA Sequence: DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCSTFPNQMIEYGKSQGRDIHYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGYExpression Region: 220-393aaSequence Info: Full LengthSource: YeastTag Info: N-terminal 6xHis-taggedMW: 21.9 kDaAlternative Name(s): Staphylococcal cysteine proteinase B Staphylopain BRelevance: Cysteine protease able to degrade elastin, fibrogen, fibronectin and kininogen. Exhibits a strong preference for substrates where arginine is preceded by a hydrophobic amino acid. Promotes detachment of primary human keratinocytes. Along with other extracellular proteases is involved in colonization and infection of human tissuesReference: "Genetic characterization of staphopain genes in Staphylococcus aureus." Golonka E., Filipek R., Sabat A., Sinczak A., Potempa J. Biol. Chem. 385:1059-1067(2004)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Related
Related
Related
Related