Recombinant Uncharacterized protein yhdV(yhdV)

GeneBio Verified independent store

→

Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Escherichia coli O157:H7Uniprot NO.:P64623Tag Info:The tag type will be determin ed during production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:MKRLIPVALLTALLAGCAHDSPCVPVYDDQGRLVHTNTCMKGTTQDNWETAGAIAGGAAA VAGLTMGIIALSKProtein Names:Recommended name: Uncharacterized protein yhdVGene Names:Name:yhdV Ordered Locus Names:Z4628, ECs4140Expression Region:1-73Sequence Info:full length protein Show more