one morphogenetic protein (BMP) constitutes a subfamily of structurally related signaling proteins within the TGF-β superfamily. Members of this superfamily are widely distributed throughout the body and participate in various physiological processes both prenatally and postnatally. Similar to BMP-7, BMP-4 is also involved in the development and maintenance of bone and cartilage. Reduced expression of BMP-4 is associated with many skeletal disorders, including genetic disorders such as fibrodysplasia ossificans progressiva. Mature mouse and human BMP-4 share 98% amino acid homology. This product features high activity, high purity, and low endotoxin levels. The product's biological activity and batch-to-batch consistency are ensured through validation and testing of biological activity, endotoxin levels, and SDS-PAGE. Our product is provided in carrier-free form, making it suitable for cell culture, ELISA, or immunoblotting standard research and production. Product Properties: Alias: Bone Morphogenetic Protein 4; BMP4; BMP2B; BMP-2B; BMP2B1; Uniprot No.: P21275 Expression System and Expression Range: E.coli-derived Mouse BMP-4 protein, Lys303-Arg408 with His tag at the C-terminus Molecular Weight: Approximately 14 kDa. Amino Acid Sequence: MKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTL VNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Purity: > 98% as determined by SDS-PAGE. Biological Activity: Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is 10 ng/mL. The specific activity of recombinant mouse BMP-4 is > 1 x 10^5 IU/mg. Endotoxin: < 0.1 EU per 1μg of the protein by the LAL method. Formulation: Lyophilized from a 0.2 μm filtered concentrated solution in 1×PBS, pH 4.5. Usage: Reconstitute the lyophilized powder with sterile water, with a solution concentration not less than 100 μg/mL, and let it stand for at least 20 minutes for complete dissolution. The reconstituted solution can be further diluted and aliquoted, with a shelf life of 1 month at 2-8°C and 3 months at -20°C; avoid repeated freeze-thaw cycles. When further diluting the reconstituted solution, add a certain amount of carrier protein (0.1% BSA, 10% FBS, or 5% HSA). For serum-free experiments, it can be replaced with a 5% sucrose solution as a carrier. Transportation and Storage: Shipped on ice packs. Store at -20°C, with a shelf life of one year. It is recommended to aliquot and store frozen for the first use to avoid repeated freeze-thaw cycles. Precautions: For your safety and health, wear lab coats and disposable gloves during operation. This product is for research purposes only.
Related
Related